PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g004310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 227aa    MW: 24532.7 Da    PI: 4.423
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g004310.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-098402254
                    SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54
                     ryps +++  LA+++gL+ +qV++WF N R +
  Csa10g004310.1  8 LRYPSDADKHLLARQTGLSRNQVSNWFINARVR 40
                    59*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.515144IPR001356Homeobox domain
SMARTSM003890.0057148IPR001356Homeobox domain
SuperFamilySSF466891.11E-12851IPR009057Homeodomain-like
CDDcd000863.88E-11945No hitNo description
PfamPF059203.8E-131040IPR008422Homeobox KN domain
Gene3DG3DSA:1.10.10.609.7E-181050IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MSFSGLFLRY PSDADKHLLA RQTGLSRNQV SNWFINARVR LWKPMVEEMY QQESKERERE  60
EELEVNEEDQ ETKNSNNDKS TKSNNNESNF TASRTTSQTP IITAPDVSDA DADAAVAVAT  120
GHRLRSDINA YENDPSSLLL PSSYSNAAAS SADLGSRYGG SAAFSAVATC QQGVGGFDDD  180
ADMGGVNVIR FGTNPTGDVS LTLGLRHAGN MPDKDPSFCV RDFGGF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1738160.0AF173816.1 Arabidopsis thaliana bel1-like homeodomain 2 (BLH2) mRNA, complete cds.
GenBankAY0504590.0AY050459.1 Arabidopsis thaliana AT4g36870/C7A10_490 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010432123.11e-168PREDICTED: BEL1-like homeodomain protein 2
SwissprotQ9SW806e-93BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLR0GY961e-105R0GY96_9BRAS; Uncharacterized protein
TrEMBLR0GH261e-105R0GH26_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_70003082e-98(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21662466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.23e-70BEL1-like homeodomain 2